The Amino Acid Sequence of Monal Pheasant Lysozyme and Its Activity
نویسندگان
چکیده
منابع مشابه
Reptile lysozyme: the complete amino acid sequence of soft-shelled turtle lysozyme and its activity.
Soft-shelled turtle egg-white lysozyme was purified and sequenced. Lysozyme was reduced and carboxymethylated to fragment it with trypsin, V8 protease and CNBr. The peptides yielded were purified by RP-HPLC and sequenced. Every trypsin peptide was overlapped by V8 protease peptides and CNBr fragment. The amino acid sequence was compared with other lysozymes. This lysozyme has an extra Gly resid...
متن کاملThe amino acid sequence of lysozyme from kalij pheasant (Lophura leucomelana) egg-white.
The amino acid sequence of kalij pheasant lysozyme has been analyzed. From the comparison of the tryptic peptide pattern of kalij pheasant lysozyme and maps from other bird lysozymes followed by the sequencing of tryptic peptides, the amino acid sequence of kalij pheasant was found to be: KVYGRCELAAAMKRLGLDNYRGYSLGNWVCAAKYESNFNTHATNRNTDGSTDYGIL- QINSRWWCNDGKTPGSRNLCHIPCSALLSSDITASVNCAKKIVSDGNGM...
متن کاملAmino Acid Sequence in Lysozyme
The previous paper in this series (Thompson, 1955) reported some amino acid sequences in lysozyme which were deduced from the structures of a number of small peptides isolated from partial acid hydrolysates by displacement chromatography on ion-exchange resins and further fractionation on paper chromatograms. Despite the success achieved by Partridge and co-workers (see Partridge & Brimley, 195...
متن کاملThe amino acid sequence of satyr tragopan lysozyme and its activity.
The amino acid sequence of satyr tragopan lysozyme and its activity was analyzed. Carboxymethylated lysozyme was digested with trypsin and the resulting peptides were sequenced. The established amino acid sequence had three amino acid substitutions at positions 103 (Asn to Ser), 106 (Ser to Asn), and 121 (His to Gln) comparing with Temminck's tragopan lysozyme and five amino acid substitutions ...
متن کاملThe Amino Acid Sequence of Egg White Lysozyme.
The separation and characterization of peptic and chymotryptic peptides of egg white lysozyme by phosphocellulose chromatography has been reported (1). In addition, a group of 18 different tryptic peptides of lysozyme, the total composition of which approximates that of the whole protein, has been characterized (2). This communication reports further studies that define a unique sequence for th...
متن کاملذخیره در منابع من
با ذخیره ی این منبع در منابع من، دسترسی به آن را برای استفاده های بعدی آسان تر کنید
ژورنال
عنوان ژورنال: Bioscience, Biotechnology, and Biochemistry
سال: 1998
ISSN: 0916-8451,1347-6947
DOI: 10.1271/bbb.62.1988